Gene Mb2032
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | antitoxin vapb15 |
| Comments | Mb2032, -, len: 80 aa. Equivalent to Rv2009, len: 80 aa, from Mycobacterium tuberculosis strain H37Rv,(98.8% identity in 80 aa overlap). Conserved hypothetical protein, very similar to Rv1560|MTCY48.05c (54.4% identity in 68 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2236946 | 2237188 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2032|vapb15
MYSGVVSRTNIEIDDELVAAAQRMYRLDSKRSAVDLALRRLVGEPLGRDEALALQGSGFDFSDDEIESFSDTDRKLADES
Bibliography
No article yet recorded