Gene Mb2033
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | toxin vapc15 |
| Comments | Mb2033, -, len: 132 aa. Equivalent to Rv2010, len: 132 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 132 aa overlap). Conserved hypothetical protein, similar to Rv1561|MTCY48.04c, (38.1% identity in 126 aa overlap) |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2237189 | 2237587 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2033|vapc15
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAIHRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
Bibliography
No article yet recorded