Gene Mb2037
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | transposase |
| Comments | Mb2037, -, len: 196 aa. Equivalent to Rv2014, len: 196 aa, from Mycobacterium tuberculosis strain H37Rv, (). Possible transposase, similar to insertion elements e.g. sp|P14707|YM3_STRCO MINI-CIRCLE HYPOT HETICAL 45.7 KD P (414 aa) opt: 249 z-score: 307.0 E(): 1.4e-09; 33.1% identity in 169 aa overlap; and YI90_MYCPA P14322 insertion element is900 hypothetical protein (399 a a),FASTA scores, opt: 242, z-score: 299.9, E(): 3.7e-10, (3 2.5% identity in 163 aa overlap); possibly made by frameshifting with respect to upstream ORF. Length changed since first submission. |
| Functional category | Insertion seqs and phages |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2240014 | 2240604 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2037|Mb2037
MLHDRLTGAPRGATGDEGAANAHITRAMVAALTSVATQIKTLDAQIAEQLSLHADAHIFTSLPRSGTVRAARLLAEIGDCRARFPTPESLACLAGVAPSTRQSGKVKHVGFRWAADKQLRDAVCDFAGDSRRANLWAADRYNRAIARGHDHPHAVRILARAWLYAIWHCWQDGAAYHPANHRALQALLNQDQDRAA
Bibliography
No article yet recorded