Gene Mb2055c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN [SECOND PART] |
| Comments | Mb2055c, -, len: 79 aa. Equivalent to 3' end of Rv2030c, len: 681 aa, from Mycobacterium tuberculosis strain H37Rv, (100.000% identity in 79 aa overlap). Conserved hypothetical protein that corresponds to products of two adjacent ORF's described previously MSGTUBDWN_4 (390 aa) and MSGTUBDWN_1 (385 aa). Also similar to C-terminal two-thirds of Mycobacterium tuberculosis protein Rv2143 (MTCY270.25c; 352 aa) and to Rv0571c (443 aa) and Mycobacterium leprae protein U650s MLU15184_16 (258 aa). FASTA scores: M93129|MSGTUBDWN_4 (390 aa) opt: 2530 E(): 0; 97.7% identity in 385 aa overlap and M93129|MSGTUBDWN_1 (385 aa) opt: 1983 E(): 0; 99.0% identity in 309 aa overlap. Z95388| MTCY270_25 (352 aa) opt: 882 E(): 0; 61.1 % identity in 226 aa overlap. U15184|MLU15184_16 (258 aa) opt: 549 E(): 9.8e-29; 43.8% identity in 219 aa overlap. REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis strain H37Rv, Rv2030c exists as a single gene. In Mycobacterium bovis, a frameshift due to a single base deletion (c-*) splits Rv2030c into 2 parts, Mb2055c and Mb2056c. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2260355 | 2260594 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2055c|Mb2055c
MSARLSRDAEAPLDVVRLGRAIGVVYLPATERQSHYLHVRPADQFDAMIHIDQTRALEPLEVTSRWIAGENPETYPTGL
Bibliography
No article yet recorded