Gene Mb2057c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | heat shock protein hspx (alpha-crystallin homolog) (14 kda antigen) (hsp16.3) |
Comments | Mb2057c, hspX, len: 144 aa. Equivalent to Rv2031c,len: 144 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 144 aa overlap). hspX, heat shock protein localized in the inner membrane (see citations below). Identical to P30223|14KD_MYCTU 14 KD ANTIGEN (16 kDa ANTIGEN) (HSP 16.3) of Mycobacterium tuberculosis (143 aa), FASTA scores: opt: 933, E(): 0, (100.0% identity in 143 aa overlap). BELONGS TO THE SMALL HEAT SHOCK PROTEIN (HSP20) FAMILY. Also known as alpha-crystallin and gene as acr (see some citations below). TBparse score is 0.897. |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2262411 | 2262845 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2057c|hspX MATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN
Bibliography
No article yet recorded