Gene Mb2060
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | arsr repressor protein |
Comments | Mb2060, -, len: 107 aa. Equivalent to Rv2034, len: 107 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 107 aa overlap). Probable repressor protein similar to several belonging to the ARSR FAMILY e.g. Q53040 (112 aa). FASTA scores: sptr|Q53040|Q53040 NITRILE HYDRATASE REGULATAR 2 (112 aa) opt: 167, E( ): 6.7e-06; 44.7% identity in 76 aa overlap. TBparse score is 0.905. Contains probable helix-turn-helix at aa 32-53 (S core 1350, +3.78 SD) |
Functional category | Regulatory proteins |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2265207 | 2265530 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2060|Mb2060 MSTYRSPDRAWQALADGTRRAIVERLAHGPLAVGELARDLPVSRPAVSQHLKVLKTARLVCDRPAGTRRVYQLDPTGLAALRTDLDRFWTRALTGYAQLIDSEGDDT
Bibliography
No article yet recorded