Gene Mb2064c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable sugar-transport ATP-binding protein ABC transporter |
| Comments | Mb2064c, -, len: 357 aa. Equivalent to Rv2038c,len: 357 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 357 aa overlap). Probable sugar-transport ATP-binding protein ABC transporter (see citation below), equivalent to MLCB2052.30|Z98604|MLCB2052_15 from Mycobacterium leprae (356 aa), FASTA scores: opt: 1866, E(): 0, (79.7% identity in 355 aa overlap). Also similar to multiple sugar import proteins e.g. Y08921|SRMSIK_1 msiK protein from Streptomyces reticuli (377 aa), FASTA scores: opt: 1336,E(): 0, (62.6% identity in 377 aa overlap); etc. Also similar to several proteins from Mycobacterium tuberculosis e.g. Rv2832c, Rv1238, Rv2397c, Rv3758c. Contains PS00211 ABC transporters family signature and PS00017 ATP/GTP-binding site motif A (P-loop). BELONGS TO THE ATP-BINDING TRANSPORT PROTEIN FAMILY (ABC TRANSPORTERS). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2267636 | 2268709 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2064c|Mb2064c
MASVSFEQATRRYPGTDRPALDRLDLIVGDGEFVVLVGPSGCGKTTSLRMVAGLETLDCGRIRIGERDVTEVDPKDRDVAMVFQNYALYPHMTVAQNMGFALKVAKIGKAEIRERVLAAAKLLDLQSYLDRKPKDLSGGQRQRVAMGRAIVRRPQVFLMDEPLSNLDAKLRGQTRNQIAALQRQLGTTTVYVTHDQVEAMTMGDRVAVLSDGVLQQCASPRELYRNPGNVFVAGFIGSPAMNLFRLSIADSTVSLGDWQILLPRAVVGTAAEVIIGVRPEHLELGGAGIEMDVDMVEELGADAYLYGRIVSGGCEMDQSIVARVDGRGPPERGSRVRLCPTPGHLHFFAVDGRRIPG
Bibliography
No article yet recorded