Gene Mb2072
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable lipoprotein lppI |
| Comments | Mb2072, lppI, len: 218 aa. Equivalent to Rv2046,len: 218 aa, from Mycobacterium tuberculosis strain H37Rv,(99.5% identity in 218 aa overlap). Probable lppI,lipoprotein contains signal sequence and appropriately positioned PS00013 Prokaryotic membrane lipoprotein lipid attachment site. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2275182 | 2275838 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2072|lppI
MRIAALVAVSLLIAGCPREVGGDVGQSQTIAPPAPAPSAAPSTPPAAGAPITTIVSWIEAGHPVDPAAYHVATRDGVTTQLGDDVAFSASSGTVACMTDARHTSGTLACLVRLANPPPRPETAYGEWKGGWVDFDGIHLQVGSARADPGPFVYGNGPELANGDTLSIGDYRCRSYQAGLFCVNYAHQSAVRFASAGIEPFGCLKPAPPPDGVGVAFGC
Bibliography
No article yet recorded