Gene Mb2076
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb2076, -, len: 111 aa. Equivalent to Rv2050, len: 111 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 111 aa overlap). Conserved hypothetical protein, similar to hypothetical proteins from Mycobacterium leprae, MLCB2052.03c (113 aa), and Streptomyces coelicolor A3(2), SC6D7.18c (124 aa). FASTA scores: Z98604|MLCB2052_3 Mycobacterium leprae cosmid B2052 (113 aa) opt: 737, E(): 0, (97.3% identity in 111 aa overlap) and (55% identity in 85 aa overlap) with emb|CAB61670.1|AL133213 hypothetical protein SC6D7.18c. TBparse score is 0.884 |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2291734 | 2292069 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2076|Mb2076 MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDAEIPGTWLCRNGMEGTLIEGDLPEPKKVKPPRTHWDMLLERRSIEELEELLKERLELIRSRRRG
Bibliography
No article yet recorded