Gene Mb2079c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable transmembrane protein fxsa |
| Comments | Mb2079c, -, len: 175 aa. Equivalent to Rv2053c,len: 175 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 175 aa overlap). Probable transmembrane protein |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2296435 | 2296962 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2079c|fxsa
MSRLLLSYAVVELAVVFALAATIGFGWTLLVLLATFVLGFGLLAPLGGWQLGRRLLWLRSGLAEPRSALSDGALVTVASVLVLVPGLVTTTMGLLLLVPPIRALARPGLTAIAVRGFLRNVPLTADAAANMAGAFGESGTDPDFIDGEVIDVIDVEPLTLQPPRVAAEPPSPGSN
Bibliography
No article yet recorded