Gene Mb2081c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 30s ribosomal protein s18 rpsr2 |
| Comments | Mb2081c, rpsR2, len: 88 aa. Equivalent to Rv2055c,len: 88 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 88 aa overlap). Probable rpsR2,ribosomal protein S18, similar to others e.g. RR18_ODOSI|P49505 chloroplast 30S ribosomal protein S18 (72 aa), FASTA scores: opt: 209, E(): 4.7e-09, (51.6% identity in 64 aa overlap); etc. Also similar to rpsR|Rv0055|MTCY21D4.18 from Mycobacterium tuberculosis (50.0% identity in 84 aa overlap). |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2298000 | 2298266 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2081c|rpsR2
MAAKSARKGPTKAKKNLLDSLGVESVDYKDTATLRVFISDRGKIRSRGVTGLTVQQQRQVAQAIKNAREMALLPYPGQDRQRRAALCP
Bibliography
No article yet recorded