Gene Mb2082c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 30s ribosomal protein s14 rpsn2 |
| Comments | Mb2082c, rpsN2, len: 101 aa. Equivalent to Rv2056c,len: 101 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 101 aa overlap). Probable rpsN2,ribosomal protein S14, similar to others e.g. RS14_ECOLI|P02370 30S ribosomal protein S14 from Escherichia coli (100 aa), FASTA scores: opt: 290; E(): 1.7e- 13; (46.0% identity in 100 aa overlap); etc. Also similar to rpsN|Rv0717|MTCY210.36 from Mycobacterium tuberculosis, (50.0% identity in 62 aa overlap). |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2298267 | 2298572 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2082c|rpsN2
MAKKSKIVKNQRRAATVARYASRRTALKDIIRSPSSAPEQRSTAQRALARQPRDASPVRLRNRDAIDGRPRGHLRKFGLSRVRVRQLAHDGHLPGVRKASW
Bibliography
No article yet recorded