Gene Mb2083c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 50s ribosomal protein l33 rpmg1 |
| Comments | Mb2083c, rpmG1, len: 54 aa. Equivalent to Rv2057c,len: 54 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 54 aa overlap). Probable rpmG1,ribosomal protein L33. FASTA results: RL33_ECOLI P02436 50S ribosomal protein L33 (54 aa) opt: 183; E(): 1.6e-09; 51.0% identity in 49 aa overlap. Note that previously known as rpmG. |
| Functional category | - |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2298574 | 2298738 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2083c|rpmG1
MARTDIRPIVKLRSTAGTGYTYTTRKNRRNDPDRLILRKYDPILRRHVDFREER
Bibliography
No article yet recorded