Gene Mb2084c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 50s ribosomal protein l28 rpmb2 |
| Comments | Mb2084c, rpmB2, len: 78 aa. Equivalent to Rv2058c,len: 78 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 78 aa overlap). Probable rpmB2,ribosomal protein L28, very similar to rL28 of M. tuberculosis. FASTA results: RL28_MYCTU Q10879 50S ribosomal protein L28. mycobacter (94 aa) opt: 338; E(): 9.8e-19; 64.9% identity in 77 aa overlap. Also similar to rpmB (Rv0105c) of Mycobacterium tuberculosis. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2298738 | 2298974 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2084c|rpmB2
MSAHCQVTGRKPGFGNTVSHSHRRSRRRWSPNIQQRTYYLPSEGRRIRLRVSTKGIKVIDRDGIEAVVARLRRQGQRI
Bibliography
No article yet recorded