Gene Mb2087c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb2087c, -, len: 134 aa. Equivalent to Rv2061c,len: 134 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 134 aa overlap). Conserved hypothetical protein. Similar to conserved hypothetical proteins from Mycobacterium leprae (128 aa) and Streptomyces coelicolor (153 aa). Smith-Waterman scores: >emb|CAC30396.1| (AL583922) [Mycobacterium leprae], Expect = 7e-47, Identities = 92/131 (70%); >emb|CAC14932.1| (AL449216) [Streptomyces coelicolor], Expect = 6e-19 Identities = 48/124 (38%). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2300594 | 2300998 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2087c|Mb2087c
MTPTFSDLAEAQYLLLTTFTKDGRPKPVPIWAALDTDRGDRLLVITEKKSWKVKRIRNTPRVTLATCTLRGRPTSEAVEATAAILDESQTGAVYDAIVKRYGIQGKLFTFVSKLRGGMRNNIGLELKVAESETG
Bibliography
No article yet recorded