Gene Mb2091
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | precorrin-8x methylmutase cobh (aka precorrin isomerase) |
| Comments | Mb2091, cobH, len: 208 aa. Equivalent to Rv2065,len: 208 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 208 aa overlap). Probable cobH,precorrin-8X methylmutase (aka precorrin isomerase) (EC 5.4.1.2), similar to COBH_PSEDE P21638 precorrin isomerase (210 aa), FASTA scores: opt: 750, E(): 0, (55.4% identity in 202 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2306465 | 2307091 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2091|cobH
MLDYLRDAAEIYRRSFAVIRAEADLARFPADVARVVVRLIHTCGQVDVAEHVAYTDDVVARAGAALAAGAPVLCDSSMVAAGITTSRLPADNQIVSLVADPRATELAARRQTTRSAAGVELCAERLPGAVLAIGNAPTALFRLLELVDEGAPPPAAVLGGPVGFVGSAQAKEELIERPRGMSYLVVRGRRGGSAMAAAAVNAIASDRE
Bibliography
No article yet recorded