Gene Mb2096c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | precorrin-6x reductase cobk |
Comments | Mb2096c, cobK, len: 231 aa. Similar to Rv2070c,len: 244 aa, from Mycobacterium tuberculosis strain H37Rv,(98.7% identity in 227 aa overlap). Probable cobK,precorrin-6x reductase (EC 1.3.1.54), similar to e.g. L21196|g347169|RERCOBLMK3 RERCOBLMKN from Rhodococcus sp. NI86/21 (248 aa), FASTA scores: opt: 792, E(): 0, (53.6% identity in 250 aa overlap). Also similarity to CBIJ_SALTY|Q05591 cbij protein from Salmonella typhimurium (263 aa), FASTA scores: opt: 166, E(): 9e-0 5, (26.7% identity in 258 aa overlap). REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a single base insertion (*-a) leads to a shorter product with a different NH2 part compared to its homolog in Mycobacterium tuberculosis strain H37Rv (231 aa versus 244 aa). |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2311404 | 2312099 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2096c|cobK MRWRKSCNPHVEIVSSLAGRVPNPALPIGPVRIGGFGGVEGLRGWLREERIDAVVDATHPFAVTITAHAAQVCGELGLPYLVLARPPWDPGTAIIAVSDIEAADVVAEQGYSRVFLTTGRSGIAAFANSDAWFLIRVVTAPDGTALPRRHKLVLSRGPYGYHDEFALLREQRIDALVTKNSGGKMTRAKLDAAAALGISVVMIARPLLPAGVAAVDSVHRAAMWVAGLPSR
Bibliography
No article yet recorded