Gene Mb2098c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | Probable precorrin-6y methyltransferase CobLb [SECOND PART] |
Comments | Mb2098c, cobLb, len: 294 aa. Equivalent to 3' end of Rv2072c, len: 390 aa, from Mycobacterium tuberculosis strain H37Rv, (99.7% identity in 294 aa overlap). Probable cobL, methyl transferase (EC 2.1.1.132), similar to L21196|g347169|RERCOBLMK1 from Rhodocococcus sp. NI86/21 (447 aa), FASTA scores: opt: 892; E(): 0; (50.1% identity in 369 aa overlap), and to COBL_PSEDE|P21921 precorrin-6y methylase (413 aa), FASTA scores: opt: 830, E(): 0, (40.6% identity in 404 aa overlap). REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a large 2029 bp deletion (H37Rv2.2330073-2332101-*)(RD9) leads to the loss of the NH2 part of cobL, the entire Rv2073 and Rv2074, and the COOH part of Mb2100c. In addition, while cobL exists as a single gene in Mycobacterium tuberculosis strain H37Rv, in Mycobacterium bovis a frameshift due to a single base insertion (*-t) splits cobL into 2 parts, cobLa and cobLb. |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2312888 | 2313772 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2098c|cobLb MPHVSAVTLACARMGWNVYDTEVISLVTAQPHTAVRRGGRAIVLSGDRSTPQALAVLLTEHGRGDSKFSVLEQLGGPAERRRDGTARAWACDPPLDVDELNVIAVRYLPDERTSWAPDEAFAHDGQITKHPIRVLTLAALAPRPGQRLWDVGAGSGAIAVQWCRSWPGCTAVAFERDERRRRNIGFNAAAFGVSVDVRGDAPDAFDDAARPSVIFLGGGVTQPGLLEACLDSLPAGGNLVANAVTVESEAALAHAYSRLGGELRRFQHYLGEPLGGFTGWRPQLPVTQWSVTKR
Bibliography
No article yet recorded