Gene Mb2099c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable precorrin-6y methyltransferase CobLa [FIRST PART] |
| Comments | Mb2099c, cobLa, len: 62 aa. Similar to 5' end of Rv2072c, len: 390 aa, from Mycobacterium tuberculosis strain H37Rv, (97.727% identity in 44 aa overlap). Probable cobL, methyl transferase (EC 2.1.1.132), similar to L21196|g347169|RERCOBLMK1 from Rhodocococcus sp. NI86/21 (447 aa), FASTA scores: opt: 892; E(): 0; (50.1% identity in 369 aa overlap), and to COBL_PSEDE|P21921 precorrin-6y methylase (413 aa), FASTA scores: opt: 830,E(): 0, (40.6% identity in 404 aa overlap). REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a large deletion of 2029 bp (H37Rv2.2330073-2332101-*) (RD9) leads to the loss of the NH2 part of cobL, the entire Rv2073 and Rv2074, and the COOH part of Mb2100c. In addition, while cobL exists as a single gene in Mycobacterium tuberculosis strain H37Rv, in Mycobacterium bovis a frameshift due to a single base insertion (*-t) splits cobL into 2 parts, cobLa and cobLb. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2313714 | 2313902 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2099c|cobLa
MLPAVQGLSPDGADLHVVASGDPLLHGIGSTLIRLFGHDNVTVFAARVRGDVGVRPDGLERV
Bibliography
No article yet recorded