Gene Mb2100c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | Possible hypothetical exported or envelope protein |
Comments | Mb2100c, -, len: 262 aa. Equivalent to 5' end of Rv2075c, len: 487 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 259 aa overlap). Possibly exported or envelope protein; has potential signal peptide at N-terminus and hydrophobic stretch around residue 430. REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a large 2029 bp deletion (RD9) leads to the loss of the COOH part of Mb2100c, the entire Rv2074 and Rv2073, and the NH2 part of cobL compared to its homolog in Mycobacterium tuberculosis strain H37Rv. |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2313977 | 2314765 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2100c|Mb2100c MPRARWLQSAALMGALAVVLITAAPVAADAYQVPAPPSPTASCDVISPVAIPCVALGKFADAVAAECRRVGVPDARCVLPLAHRVTQAARDAYLQSWVHRTARFQDALQDPVPLRETQWLGTHNSFNSLSDSFTVSHADSNQQLSLAQQLDIDVRALELDLHYLPRLEGHGAPGVTVCHGLGPKNANLGCTVEPLLATVLPQIANWLNAPGHTEEVILLYLEDQLKNASAYESVVATLDQVLRRADGTSLIYRPNPARRGPQ
Bibliography
No article yet recorded