Gene Mb2106
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | lipoprotein lppj |
| Comments | Mb2106, lppJ, len: 187 aa. Equivalent to Rv2080,len: 187 aa, from Mycobacterium tuberculosis strain H37Rv,(99.5% identity in 187 aa overlap). Possible lppJ,lipoprotein; contains prokayotic lipoprotein modification site (PS00013) and signal sequence at N-terminus. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2319192 | 2319755 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2106|lppJ
MPHSTADRRLRLTRQALLAAAVAPLLAGCALVMHKPHSAGSSNPWDDSAHPLTDDQAMAQVVEPAKQIVAAADLQAVRAGFSFTSCNDQGDPPYQGTVRMAFLLQGDHDAYFQHVRAAMLSHGWIDGPPPGQYFHGITLHKNGVTANMSLALDHSYGEMILDGECRNTTDHHHDDETTNITNQLVQP
Bibliography
No article yet recorded