Gene Mb2107c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved transmembrane protein |
| Comments | Mb2107c, -, len: 147 aa. Equivalent to Rv2081c,len: 146 aa, from Mycobacterium tuberculosis strain H37Rv,(99.3% identity in 147 aa overlap). Possible transmembrane unknown protein. Hydrophobic stretch from aa 32-54. REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a 3 bp insertion (*-ggg) leads to a slightly longer product compared t its homolog in Mycobacterium tuberculosis strain H37Rv (147 aa versus 146 aa). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2319951 | 2320394 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2107c|Mb2107c
MFANAGLSPFVAIWTARAASLYTSHNFWCAAAVSAAVYVGSAVVPAAVAGPLFVGRVSATIKAAAPSTTAAIATLATAANGQLRERGGAGGWVGVHCPVVGGGGGVGHPRKAIAAAVSVHSTCMPAAFGGHLGLGDRSRSVSLSGTP
Bibliography
No article yet recorded