Gene Mb2116c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | dipeptidase pepe |
| Comments | Mb2116c, pepE, len: 375 aa. Equivalent to Rv2089c,len: 375 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 375 aa overlap). Probable pepE,dipeptidase, similar to e.g. PEPQ_LACDL P46545, xaa-pro dipeptidase (368 aa), FASTA scores, opt: 617, E(): 5.1 e-32, (34.7% identity in 363 aa overlap); contains PS00491 Aminopeptidase P and proline dipeptidase signature. Also similar to Mycobacterium tuberculosis peptidases Rv2861c,Rv0734, Rv2535c. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2328097 | 2329224 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2116c|pepE
MGSRRFDAEVYARRLALAAAATADAGLAGLVITPGYDLCYLIGSRAETFERLTALVLPAAGAPAVVLPRLELAALKQSAAAELGLRVCDWVDGDDPYGLVSAVLGGAPVATAVTDSMPALHMLPLADALGVLPVLATDVLRRLRMVKEETEIDALRKAGAAIDRVHARVPEFLVPGRTEADVAADIAEAIVAEGHSEVAFVIVGSGPHGADPHHGYSDRELREGDIVVVDIGGTYGPGYHSDSTRTYSIGEPDSDVAQSYSMLQRAQRAAFEAIRPGVTAEQVDAAARDVLAEAGLAEYFVHRTGHGIGLCVHEEPYIVAGNDLVLVPGMAFSIEPGIYFPGRWGARIEDIVIVTEDGAVSVNNCPHELIVVPVS
Bibliography
No article yet recorded