Gene Mb2130c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible antitoxin vapb37 |
Comments | Mb2130c, -, len: 84 aa. Equivalent to Rv2104c, len: 84 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 84 aa overlap). Conserved hypothetical protein, similar to members of a family of hypothetical mycobacterial proteins including Rv2871, Rv1241, Rv2132,Rv3321c, Rv1113, Rv0657, Rv1560, etc. FASTA scores: sptr|Q49787|Q49787 B2126_C2_217 (97 aa) opt: 197, E(): 2e-07; 57.1% identity in 56 aa overlap and Z95388|MTCY270_36 Mycobacterium tuberculosis cosmid (76 aa ) opt: 142, E(): 0.0011; 41.8% identity in 55 aa overlap. |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2346368 | 2346622 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2130c|vapb37 MRTTVTLDDDVEQLVRRRMAERQVSFKKALNDAIRDGASGRPAPSHFSTRTADLGVPAVNLDRALQLAADLEDEELVRRQRRGS
Bibliography
No article yet recorded