Gene Mb2131
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | pe family protein pe22 |
| Comments | Mb2131, PE22, len: 98 aa. Equivalent to Rv2107,len: 98 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 98 aa overlap). Member of mycobacterial PE family e.g. Y03A_MYCTU Q10637 hypothetical glycine-rich 49.6 kd protein (603 aa), FASTA scores; opt: 214 E(): 1.3e-14, 39.8% identity in 93 aa overlap |
| Functional category | Pe/ppe |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2347842 | 2348138 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2131|PE22
MSFVNVDPFGMLAAAATLESLGSHMAVSNAAVASVTTKVPPPAADYVSKKLSLFFSSHGQQYQVQAARGTAFHRKLVRTLANGALAYEEVEIANNEGF
Bibliography
No article yet recorded