Gene Mb2134c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | proteasome beta subunit prcb; assembles with alpha subunit prca. |
| Comments | Mb2134c, prcB, len: 291 aa. Equivalent to Rv2110c,len: 291 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 291 aa overlap). prcB, proteasome beta-type subunit 2, highly similar to eg. TR:Q53083 (EMBL:U264 22) proteasome beta-type subunit 2 from Rhodococcus (292 aa), FASTA scores; opt: 1103, E(): 0,64.5% identity in 262 aa overlap. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2350208 | 2351083 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2134c|prcB
MTWPLPDRLSINSLSGTPAVDLSSFTDFLRRQAPELLPASISGGAPLAGGDAQLPHGTTIVALKYPGGVVMAGDRRSTQGNMISGRDVRKVYITDDYTATGIAGTAAVAVEFARLYAVELEHYEKLEGVPLTFAGKINRLAIMVRGNLAAAMQGLLALPLLAGYDIHASDPQSAGRIVSFDAAGGWNIEEEGYQAVGSGSLFAKSSMKKLYSQVTDGDSGLRVAVEALYDAADDDSATGGPDLVRGIFPTAVIIDADGAVDVPESRIAELARAIIESRSGADTFGSDGGEK
Bibliography
No article yet recorded