Gene Mb2146c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | phosphoribosyl-amp pyrophosphatase hise |
| Comments | Mb2146c, hisE, len: 93 aa. Equivalent to Rv2122c,len: 93 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 93 aa overlap). Probable hisE (alternate gene name: irg1), phosphoribosyl-AMP cyclohydrolase (EC 3.6.1.31) (see citation below), similar to N-terminus of e.g. HIS2_SYNY3 P74755 phosphoribosyl-AMP cyclohydrolase (230 aa), FASTA scores; opt: 150, E(): 4e-08, (37.9% identity in 87 aa overlap); etc. Note that previously misnamed hisI. |
| Functional category | - |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2361088 | 2361369 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2146c|hisE
MQQSLAVKTFEDLFAELGDRARTRPADSTTVAALDGGVHALGKKLLEEAGEVWLAAEHESNDALAEEISQLLYWTQVLMISRGLSLDDVYRKL
Bibliography
No article yet recorded