Gene Mb2164c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein tb18.6 |
Comments | Mb2164c, TB18.6, len: 176 aa. Equivalent to Rv2140c, len: 176 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 176 aa overlap). TB18.6,conserved hypothetical protein; shows good similarity to hypothetical proteins from Streptomyces coelicolor (177 aa; 58% identity) >emb|CAC32358.1| (AL583945) and to 17.1 kd Escherichia coli protein YbhB. FASTA best: YBHB_ECOLI P12994 hypothetical 17.1 kd protein (158 aa) opt: 465 E( ): 2e-23; (46.2% identity in 156 aa overlap). |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2380196 | 2380726 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2164c|TB18.6 MTTSPDPYAALPKLPSFSLTSTSITDGQPLATPQVSGIMGAGGADASPQLRWSGFPSETRSFAVTVYDPDAPTLSGFWHWAVANLPANVTELPEGVGDGRELPGGALTLVNDAGMRRYVGAAPPPGHGVHRYYVAVHAVKVEKLDLPEDASPAYLGFNLFQHAIARAVIFGTYEQR
Bibliography
No article yet recorded