Gene Mb2170c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | Possible conserved transmembrane protein |
Comments | Mb2170c, -, len: 96 aa. Equivalent to Rv2146c, len: 96 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 96 aa overlap). Possible conserved transmembrane protein, orthologs present in Mycobacterium leprae, ML0921 (96 aa) and Streptomyces coelicolor. Second start taken GTG alternative upstream but much less probable in TBparse. FASTA best: Q44935 SIMILAR TO A HYPOTHETICAL INTEGRAL MEMBRANE PROT EIN (97 aa) opt: 105,E(): 0.093; (25.3% identity in 87 aa overlap). >emb|CAC31302.1| (AL583920) possible membrane protein ML0921 [Mycobacterium leprae] E(): 5e-32 (76% identity in 96 aa overlap) |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2386180 | 2386470 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2170c|Mb2170c MVVFFQILGFALFIFWLLLIARVVVEFIRSFSRDWRPTGVTVVILEIIMSITDPPVKVLRRLIPQLTIGAVRFDLSIMVLLLVAFIGMQLAFGAAA
Bibliography
No article yet recorded