Gene Mb2193
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | Probable conserved lipoprotein lppM |
Comments | Mb2193, lppM, len: 227 aa. Equivalent to Rv2171,len: 227 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 227 aa overlap). Probable lppM,conserved lipoprotein; contains putative signal peptide and appropriately positioned PS00013 Prokaryotic membrane lipoprotein lipid attachment site. Has hydrophobic stretch at C-terminus and also contains PS00225 Crystallins beta and gamma 'Greek key' motif signature. Unknown but equivalent to Mycobacterium leprae lipoprotein ML0902 (239 aa). FASTA scores: opt: 1083, E(): 2.4e-56; 75.446% identity in 224 aa overlap (5-227:16-239) >emb|CAA18680.1| (AL022602) >gi|13092972|emb|CAC31283.1| (AL583920). |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2411985 | 2412668 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2193|lppM MARTRRRGMLAIAMLLMLVPLATGCLRVRASITISPDDLVSGEIIAAAKPKNSKDTGPALDGDVPFSQKVAVSNYDSDGYVGSQAVFSDLTFAELPQLANMNSDAAGVNLSLRRNGNIVILEGRADLTSVSDPDADVELTVAFPAAVTSTNGDRIEPEVVQWKLKPGVVSTMSAQARYTDPNTRSFTGAGIWLGIAAFAAAGVVAVLAWIDRDRSPRLTASGDPPTS
Bibliography
No article yet recorded