Gene Mb2197c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved regulatory protein |
| Comments | Mb2197c, -, len: 146 aa. Equivalent to Rv2175c,len: 146 aa, from Mycobacterium tuberculosis strain H37Rv,(99.3% identity in 146 aa overlap). Conserved hypothetical protein, possibly involved in regulation. Contains possible helix-turn-helix domain at aa 31-52 (Score 1042,+2.74 SD). Equivalent to Mycobacterium leprae ML0898 putative DNA-binding protein (134 aa). FASTA scores: opt: 747; 82.090% identity in 134 aa overlap (AL022602) >gi|13092969|emb|CAC31279.1| (AL583920) |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2416480 | 2416920 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2197c|Mb2197c
MPGRAPGSTLARVGSILAGDDVLDPDEPTYDLPRVAELLGVPVSKVAQQLREGHLVAVRRAGGVVIPQVFFTNSGQVVKSLPGLLTILHDGGYRDTEIMRWLFTPDPSLTITRDGSRDAVSNARPVDALHAHQAREVVRRAQAMAY
Bibliography
No article yet recorded