Gene Mb2202c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved integral membrane protein |
| Comments | Mb2202c, -, len: 295 aa. Equivalent to Rv2180c,len: 295 aa, from Mycobacterium tuberculosis strain H37Rv,(99.7% identity in 295 aa overlap). Probable conserved integral membrane protein, similar to pir||T35292 probable integral membrane protein from Streptomyces coelicolor >gi|5578858|emb|CAB51260.1| (AL096872) (246 aa) (36% identity in 249 aa overlap). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2421361 | 2422248 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2202c|Mb2202c
MEVFHWLQHDIVDRGRLPLLCCLVAFVLTFLVTRSFVRFIHRRAADGRPARWWQPRNVHIGSVHIHHVAFGVVLVMISGLTLVTLSVDGREPEFTIAASIFGVGAALVLDEYALILHLSDVYWEEDGRTSVDAVFAAVAVAGLLIMGLHPLIFFLTVRQGANWVVLQTTLIAGLVLTLPLAVVVLLKGKVWTGLLGMFVVVLLVVGAVRLSRPHAPWARWRYTRHPEKMRRALQRERTWRRPVVRIKLWLQYVIAGTPRMPDERAVDAQLDQDVRPAPPPERTAPILISGSVWSD
Bibliography
No article yet recorded