Gene Mb2205c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb2205c, -, len: 131 aa. Equivalent to Rv2183c,len: 131 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 131 aa overlap). Conserved hypothetical protein, equivalent to Mycobacterium leprae hypothetical protein ML0891 (MLCB268.25c, 130 aa). FASTA scores: opt: 558, E(): 8.3e-28; 61.832% identity in 131 aa overlap >gi|13092963|emb|CAC31272.1| (AL583920) (AL022602). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2424449 | 2424844 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2205c|Mb2205c
MSGAHTDVRPELRKLAQAILDGIDPAVRVAAAMASGGGPGTGKCQQVWCPLCALAALVTGEQHPLLTVIADHSLALLEVIRAIVDDIDRSAKPPPEGPPGGGQTGASGGENTNGEGSMKSHYQAIPVTIEE
Bibliography
No article yet recorded