Gene Mb2211c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | mannosyltransferase pimb |
| Comments | Mb2211c, -, len: 385 aa. Equivalent to Rv2188c,len: 385 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 385 aa overlap). Conserved hypothetical protein, possibly glycosyl transferase similar to several putative glycosyl transferases and hypothetical proteins e.g. P73369. Equivalent to Mycobacterium leprae ML0886 putative glycosyl transferase (384 aa). FASTA scores: ML0886 (CAA18697.1| (AL022602) ) opt: 2113, E(): 1.8e-106; 81.462% identity in 383 aa overlap; sptr|P73369|P73369 HYPOTHETICAL 46.2 KD PROTEIN (404 aa) opt: 379, E(): 2.2e-18; 27.5% identity in 397 aa overlap. Start changed since first submission, now 14 aa shorter. |
| Functional category | Lipid metabolism |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2429026 | 2430183 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2211c|pimb
MSRVLLVTNDFPPRRGGIQSYLGEFVGRLVGSRAHAMTVYAPQWKGADAFDDAARAAGYRVVRHPSTVMLPGPTVDVRMRRLIAEHDIETVWFGAAAPLALLAPRARLAGASRVLASTHGHEVGWSMLPVARSVLRRIGDGTDVVTFVSSYTRSRFASAFGPAASLEYLPPGVDTDRFRPDPAARAELRKRYRLGERPTVVCLSRLVPRKGQDTLVTALPSIRRRVDGAALVIVGGGPYLETLRKLAHDCGVADHVTFTGGVATDELPAHHALADVFAMPCRTRGAGMDVEGLGIVFLEASAAGVPVIAGNSGGAPETVQHNKTGLVVDGRSVDRVADAVAELLIDRDRAVAMGAAGREWVTAQWRWDTLAAKLADFLRGDDAAR
Bibliography
No article yet recorded