Gene Mb2220c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved transmembrane protein |
| Comments | Mb2220c, -, len: 214 aa. Equivalent to Rv2197c,len: 214 aa, from Mycobacterium tuberculosis strain H37Rv,(99.5% identity in 214 aa overlap). Probable conserved transmembrane protein, equivalent to ML0878 conserved hypothetical protein (212 aa) of Mycobacterium leprae. FASTA scores: opt: 858; 62.559% identity in 211 aa overlap CAC31259.1|(AL583920) |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2440651 | 2441295 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2220c|Mb2220c
MVSRYSAYRRGPDVISPDVIDRILVGACAAVWLVFTGVSVAAAVALMDLGRGFHEMAGNPHTTWVLYAVIVVSALVIVGAIPVLLRARRMAEAEPATRPTGASVRGGRSIGSGHPAKRAVAESAPVQHADAFEVAAEWSSEAVDRIWLRGTVVLTSAIGIALIAVAAATYLMAVGHDGPSWISYGLAGVVTAGMPVIEWLYSRQLRRVVAPQSS
Bibliography
No article yet recorded