Gene Mb2222c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved integral membrane protein |
| Comments | Mb2222c, -, len: 139 aa. Equivalent to Rv2199c,len: 139 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 139 aa overlap). Possible conserved integral membrane protein, similar to hypothetical membrane proteins in Actinomycetes and equivalent to Mycobacterium leprae, ML0876, putative membrane protein (139 aa) FASTA scores: opt: 866, E(): 1.1e-43; 91.367% identity in 139 aa overlap CAC31257.1| (AL583920) |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2442380 | 2442799 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2222c|Mb2222c
MHIEARLFEFVAAFFVVTAVLYGVLTSMFATGGVEWAGTTALALTGGMALIVATFFRFVARRLDSRPEDYEGAEISDGAGELGFFSPHSWWPIMVALSGSVAAVGIALWLPWLIAAGVAFILASAAGLVFEYYVGPEKH
Bibliography
No article yet recorded