Gene Mb2227c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved protein |
| Comments | Mb2227c, -, len: 118 aa. Equivalent to Rv2204c,len: 118 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 118 aa overlap). Conserved hypothetical protein. Similar to conserved hypothetical proteins in Actinomycetes and equivalent to Mycobacterium leprae ML0871|ML0871 conserved hypothetical protein (118 aa) and to sp|P45344|YADR_HAEIN HYPOTHETICAL PROTEIN HI1723 (114 aa). FASTA score: ML0871 opt: 720, E(): 8.4e-45; 92.373% identity in 118 aa overlapCAC31252.1| (AL583920); and P45344 opt: 346, E(): 1.8e-18; 45.6% identity in 103 aa overlap. Contains PS01152 Hypothetical hesB/y yadR/yfhF family signature |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2448078 | 2448434 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2227c|Mb2227c
MTVQNEPSAKTHGVILTEAAAAKAKSLLDQEGRDDLALRIAVQPGGCAGLRYNLFFDDRTLDGDQTAEFGGVRLIVDRMSAPYVEGASIDFVDTIEKQGFTIDNPNATGSCACGDSFN
Bibliography
No article yet recorded