Gene Mb2241
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable lipoate biosynthesis protein A LipA |
| Comments | Mb2241, lipA, len: 311 aa. Equivalent to Rv2218,len: 311 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 311 aa overlap). Probable lipA, lipoic acid synthetase, similar to e.g. SW:LIPA_HAEIN P44463 (42 .6% identity in 291 aa overlap). Equivalent to Z98741|MLCB2 2_12 Mycobacterium leprae cosmid B22; (314 aa). FASTA score : opt: 1836, E(): 0; 86.8% identity in 310 aa overlap |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2464420 | 2465355 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2241|lipA
MSVAAEGRRLLRLEVRNAQTPIERKPPWIKTRARIGPEYTELKNLVRREGLHTVCEEAGCPNIFECWEDREATFLIGGDQCTRRCDFCQIDTGKPAELDRDEPRRVADSVRTMGLRYATVTGVARDDLPDGGAWLYAATVRAIKELNPSTGVELLIPDFNGEPTRLAEVFESGPEVLAHNVETVPRIFKRIRPAFTYRRSLGVLTAARDAGLVTKSNLILGLGETSDEVRTALGDLRDAGCDIVTITQYLRPSARHHPVERWVKPEEFVQFARFAEGLGFAGVLAGPLVRSSYRAGRLYEQARNSRALASR
Bibliography
No article yet recorded