Gene Mb2243c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable conserved membrane protein |
| Comments | Mb2243c, -, len: 140 aa. Equivalent to Rv2219A,len: 140 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 140 aa overlap). Probable membrane protein, similar to SC3H12.05c|AL355740_5 possible integral membrane protein from Streptomyces coelicolor (155 aa), FASTA scores: opt: 327, E(): 7.5e-14, (46.6% identity in 133 aa overlap), also linked to glnA. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2466141 | 2466563 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2243c|Mb2243c
MTAKSPPDYPGKTLGLPDTGPGSLAPMGRRLAALLIDWLIAYGLALLGVEFGVWSTPMLSTVVLVIWLLLGVAAVRLFGFTPGQLMLGLVVVAVGGRRPVGIGRLVVRGLLIGLVVPPLFTDSDGRGLHDRLTATAVVRR
Bibliography
No article yet recorded