Gene Mb2251
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein [FIRST PART] |
| Comments | Mb2251, -, len: 106 aa. Equivalent to 5' end of Rv2227, len: 233 aa, from Mycobacterium tuberculosis strain H37Rv, (93.8% identity in 80 aa overlap). Conserved hypothetical protein, similar to conserved hypothetical proteins from various bacteria e.g. gb|AAK22693.1| (AE005746) conserved hypothetical protein from Caulobacter crescentus (234 aa) Smith-Waterman score = 109 bits (429),Expect = 1e-41 Identities = 83/167 (49%). REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis strain H37Rv, Rv2227 exists as a single gene. In Mycobacterium bovis, a frameshift due to a 1 bp to 2 bp substitution (t-cc) splits Rv2227 in two parts, Mb2251 and Mb2252. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2480078 | 2480398 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2251|Mb2251
MGQTRRLRRLGRHRCRGQRVRWRTATSADHPRRGRPAAQAVRRRRPVSLDGRYGIQAVRRRAVSIFPCPLSRADRASQAGAVSQTAADSAQLVGQTGPGGALARQP
Bibliography
No article yet recorded