Gene Mb2256B
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible antitoxin VapB16 |
| Comments | Mb2256B, len: 58 aa. Equivalent to Rv2231B len: 58 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 58 aa overlap). Transferred from H37Rv annotation using Rapid Annotation Transfer Tool (Nucleic Acids Res. 2011 May; 39(9): e57). Possible vapB16,antitoxin,part of toxin-antitoxin (TA) operon with Rv2231A (See Pandey and Gerdes, 2005). |
| Functional category | - |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2485355 | 2485531 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2256B|vapB16
MALWYQAMIAKFGEQVVDAKVWAPAKRVGVHEAKTRLSELLRLVYGGQRLRLPAAASR
Bibliography
No article yet recorded