Gene Mb2256c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible aminotransferase CobC |
| Comments | Mb2256c, cobC, len: 364 aa. Equivalent to Rv2231c,len: 364 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 364 aa overlap). Possible cobC,aminotransferase. Note that initiation codon uncertain. Similar to CobC aminotransferases e.g. sp|P21633|COBC_PSEDE COBC PROTEIN (333 aa) opt: 277, E(): 1.7e-11; 28.8% identity in 313 aa overlap and also to e.g. SW:HIS8_ECOLI P06986 histidinol-phosphate aminotransferase (27.0% identity in 289 aa overlap), contains PS00105 aminotransferases class-I pyridoxal-phosphate attachment site. Real Mycobacterium tuberculosis histidinol-phosphate aminotransferase, hisC, is Rv1600 (MTCY336.04c). |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2483753 | 2484847 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2256c|cobC
MLWILGPHTGPLLFDAVASLDTSPLAAARYHGDQDVAPGVLDFAVNVRHDRPPEWLVRQLAALLPELARYPSTDDVHRAQDAVAERHGRTRDEVLPLVGAAEGFALLHNLSPVRAAIVVPAFTEPAIALSAAGITAHHVVLKPPFVLDTAHVPDDADLVVVGNPTNPTSVLHLREQLLELRRPGRILVVDEAFADWVPGEPQSLADDSLPDVLVLRSLTKTWSLAGLRVGYALGSPDVLARLTVQRAHWPLGTLQLTAIAACCAPRAVAAAAADAVRLTALRAEMVAGLRSVGAEVVDGAAPFVLFNIADADGLRNYLQSKGIAVRRGDTFVGLDARYLRAAVRPEWPVLVAAIAEWAKRGGRR
Bibliography
No article yet recorded