Gene Mb2262c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable peroxiredoxin ahpe |
| Comments | Mb2262c, ahpE, len: 153 aa. Equivalent to Rv2238c,len: 153 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 153 aa overlap). ahpE, peroxiredoxin. Similarity to many members of AHPC/TSA family e.g. sp|Q96291|BAS1_ARATH 2-CYS PEROXIREDOXIN BAS1 PRECURSOR (265 aa). FASTA score: opt: 275, E(): 2.7e-12; 35.0% identity in 143 aa overlap |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2489863 | 2490324 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2262c|ahpE
MLNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPEFENDDSAALAISVGPPPTHKIWATQSGFTFPLLSDFWPHGAVSQAYGVFNEQAGIANRGTFVVDRSGIIRFAEMKQPGEVRDQRLWTDALAALTA
Bibliography
No article yet recorded