Gene Mb2278c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable integral membrane protein |
| Comments | Mb2278c, -, len: 151 aa. Equivalent to Rv2254c,len: 151 aa, from Mycobacterium tuberculosis strain H37Rv,(99.3% identity in 151 aa overlap). Probable integral membrane protein. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2507582 | 2508037 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2278c|Mb2278c
MRYRDLETVAAPTINVLRVWPEIVGAIVLLVIAAMGIGHGLRPSPEPVPAPQKQLGCVRFALIFGLTVINPATFVYFTAVAVTLARALRATTAIAVVVGVALASLLWQLLLVSAGAFLRSRATARVRRMTVLAGNAVIAAFGAVLVVHAFA
Bibliography
No article yet recorded