Gene Mb2295
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable conserved transmembrane protein |
| Comments | Mb2295, -, len: 122 aa. Equivalent to Rv2272, len: 122 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 122 aa overlap). Probable conserved transmembrane PROTEIN, similar to YIDH_ECOLI P31445 hypothetical 12.8 kd protein (115 aa), FASTA scores, opt: 291, E(): 2.9e-14, (45.6% identity in 103 aa overlap),similar to MTCY339.37c, (35.0% identity in 100 aa overlap). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2524691 | 2525059 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2295|Mb2295
MADDSNDTATDVEPDYRFTLANERTFLAWQRTALGLLAAAVALVQLVPELTIPGARQVLGVVLAILAILTSGMGLLRWQQADRAMRRHLPLPRHPTPGYLAVGLCVVGVVALALVVAKAITG
Bibliography
No article yet recorded