Gene Mb2303c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable transcription regulator (lysR family) |
| Comments | Mb2303c, -, len: 312 aa. Equivalent to Rv2282c,len: 312 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 312 aa overlap). Probable transcriptional regulator, lysR family, similar to others e.g. YC30_CYAPA|P48271 hypothetical transcriptional regulator YCF30 (324 aa), FASTA scores: opt: 292, E(): 4e-12, (27.6% identity in 286 aa overlap); etc. Also similar to Rv0377|MTCY39.34 from Mycobacterium tuberculosis, FASTA score: (25.4% identity in 268 aa overlap). Contains PS00044 Bacterial regulatory proteins,lysR family signature, and contains helix-turn-helix motif at aa 24 -45 (+4.93 SD). |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2532534 | 2533472 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2303c|Mb2303c
MPLSSRMPGLTCFEIFLAIAEAGSLGGAARELGLTQQAVSRRLASMEAQIGVRLAIRTTRGSQLTPAGIVVAEWAARLLEVADEIDAGLGSLRTEGRQRIRVVASQTIAEQLMPHWMLSLRAADMRRGGTVPEVILTATNSEHAIAAVRDGIADLGFIENPCPPTGLGSVVVARDELVVVVPPGHKWARRSRVVSARELAQTPLVTREPNSGIRDSLTAALRDTLGEDMQQAPPVLELSSAAAVRAAVLAGAGPAAMSRLAIADDLAFGRLLAVDIPALNLRRQLRAIWVGGRTPPAGAIRDLLSHITSRST
Bibliography
No article yet recorded