Gene Mb2307c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein [SECOND PART] |
| Comments | Mb2307c, -, len: 87 aa. Equivalent to 3' end of Rv2286c, len: 230 aa, from Mycobacterium tuberculosis strain H37Rv, (). Conserved hypothetical protein. Similar to Mycobacterium tuberculosis hypothetical protein,Rv2466c, AL021246|MTV008_22 (207 aa). FASTA score: opt: 324, E(): 8.9e-15; 30.4% identity in 194 aa overlap. REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis strain H37Rv, Rv2286c exists as a single gene. In Mycobacterium bovis, a frameshift due to a single base transition (c-t) splits Rv2286c into 2 parts, Mb2307c and Mb2308c. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2536473 | 2536736 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2307c|Mb2307c
MPTLFLDGQCLFGPVLVDPPAGPAALNLWSVVTGMAGLPHVYELQRPKSPADVELIAQQLRPYLDGRDWVSINRGEIVDIDRLAGRS
Bibliography
No article yet recorded