Gene Mb2308c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved hypothetical protein [FIRST PART] |
Comments | Mb2308c, -, len: 133 aa. Equivalent to 5' end of Rv2286c, len: 230 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 133 aa overlap). Conserved hypothetical protein. Similar to Mycobacterium tuberculosis hypothetical protein, Rv2466c,AL021246|MTV008_22 (207 aa). FASTA score: opt: 324, E(): 8.9e-15; 30.4% identity in 194 aa overlap. REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis strain H37Rv, Rv2286c exists as a single gene. In Mycobacterium bovis, a frameshift due to a single base transition (c-t) splits Rv2286c into 2 parts, Mb2307c and Mb2308c. |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2536764 | 2537165 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2308c|Mb2308c MTTVDFHFDPLCPFAYQTSVWIRDVRAQLGITINWRFFSLEEINLVAGKKHPWERDWSYGWSLMRIGALLRRTNMSLLDRWYAAIGHELHTLGGKPHDPAVARRLLCDVGVNAAILDAALDDPTTHDDVRADH
Bibliography
No article yet recorded