Gene Mb2313
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | Probable conserved lipoprotein lppOb |
Comments | Mb2313, lppOb, len: 121 aa. Equivalent to 3' end of Rv2290, len: 171 aa, from Mycobacterium tuberculosis strain H37Rv, (99.2% identity in 121 aa overlap). Probable lppO, conserved lipoprotein, similar to Rv3763, 19KD_MYCTU P11572 19 kd lipoprotein antigen precursor (159 aa) FASTA scores, opt: 119, E (): 1.3, (25.6% identity in 164 aa overlap). Contains appropriately positioned PS00013 lipoprotein motif (with one mismatch). REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis strain H37Rv, lppO exists as a single gene. In Mycobacterium bovis, a frameshift due to a single base deletion (c-*), splits lppO into 2 parts, lppOa and lppOb. |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2540344 | 2540709 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2313|lppOb MVEGHTHTISGAVECRTSPAVRTATPSESGTQTTRVNAHDDSASVTLSLSDSTPPDVNGFGISLKIGSVDYQMPYQPVQSPTQVEATRQGKSYTLTGTGHAVIPGQTGMRELPFGVHVTCP
Bibliography
No article yet recorded