Gene Mb2375c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | putative esat-6 like protein esxo (esat-6 like protein 6) |
| Comments | Mb2375c, esxO, len: 60 aa. Equivalent to 3' end of Rv2346c, len: 94 aa, from Mycobacterium tuberculosis strain H37Rv, (98.3% identity in 60 aa overlap). esxO,putative ESAT-6 like protein 6, conserved hypotheticalprotein, member of proteins family from Mycobacterium tuberculosis, with O53942|Rv1793|MTV049.15,O05300|Rv1198|MTCI364.10, MTCY15C10.33,P96364|MTCY07H7B.03|Rv1037c|MTCY10G2.12, MTCI364.10, etc. BELONGS TO THE ESAT6 FAMILY. REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a large 8963 bp deletion (RD5) leads to the loss of the NH2 part of Mb2375c, and the 9 following CDSs up to Rv2356 including the 3 phospolipases C enzymes plcC, plcB and plcA, compared to the homolog in Mycobacterium tuberculosis H37Rv. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2603485 | 2603667 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2375c|esxO
MLAAGDFWGGAGSVACQEFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA
Bibliography
No article yet recorded